PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00021g00523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 608aa    MW: 68393.9 Da    PI: 5.571
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00021g00523.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.93.6e-26213266155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               k r+ Wtp++H++F++a++qL G+ekA+Pk+i+e+m+ +gLt+ehv+SHLQkYR+
  Peaxi162Scf00021g00523.1 213 KRRVIWTPKMHQNFLRAIQQL-GHEKAVPKKIVEIMNEPGLTREHVASHLQKYRM 266
                               679******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.08E-825152IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.2E-1125164No hitNo description
Gene3DG3DSA:1.10.10.605.0E-26211270IPR009057Homeodomain-like
SuperFamilySSF466899.14E-18212270IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-24213266IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MDIQRVTANS SLEESTTSSD MGTKSICILV VLDDFTCDNI VTDMLHNQTY EVLHVGKIMD  60
TLNGIWERKS NLNLVLTNIH RLNTNGVDIL QIINNKLNLP TILMSPDDAR YENQIQDCNV  120
AAYVVNFSDT DEMNKLWQMA LEKEQGRKAA TNQEANDEKN ALSMPQNVTK SSTENTSSDD  180
NDAEISAHDR KGKRKAFTEK NEENGENRDI EKKRRVIWTP KMHQNFLRAI QQLGHEKAVP  240
KKIVEIMNEP GLTREHVASH LQKYRMCLKR AQESLAATSI YDQILSNDAK DKYFQFQPCL  300
SSPNFITSRG HSHSRQQPFQ AHFQQATDGL GQNLRQPQMV SIHKLSSFQQ QNSYLKFANW  360
RQTNNSGIIG QQFTSLPRLA HASNFRVYGD KTKNMLFSIQ SGSANQPTNS NSGLDFIGFK  420
LSKDGKSVHF GHKGSSCAVI SNNTYSGLCS SMSEGYIQQQ QSSSSFLETP IENTLIQCSS  480
APSENFTFHH LQATFPSTEQ HTSNSISDQQ SVLLFENATN KISCQSLEMP ASILGDLEDY  540
SAILFGDEVS VPAQENCGNY DCRQQEYSAP DEINSFGTEV DIIKSLLETT DNRSSQLFWE  600
GDTENELH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-17211270362ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192214KRKAFTEKNEENGENRDIEKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016480490.10.0PREDICTED: two-component response regulator ARR12-like
TrEMBLM1DH860.0M1DH86_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000890080.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36591620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.12e-36response regulator 1